Je was op zoek naar: dministration (Engels - Frans)

��% dministration and sta+ zegulations ��
��% dministration et statut des (onctionnaires ��

total reimbursement/a dministration 6.
total remboursement/administration 6.

!griculture 3tructural฀measures )nternal฀policies %xternal฀policies !dministration 2eserves 0re accession฀aid
!griculture !ctions฀structurelles 0olitiques฀internes !ctions฀ e x t � r i eur e s !dministration 2 � se r v e s

are pharmaceutical formulations designed for testing and human dministration in the treatment of medical conditions;
:: préparations pharmaceutiques destinées à des analyses ou à être administrées aux êtres humains pour le traitement d'états pathologiques;

just as in biology and medicine the use of computers for recording, simulation, operation and a dministration is considered urgent and essential.
en matière de biophysique, de physique médicale, de technique des mesures des radiations, d'électromédecine, et de médecine nucléaire, on dépend fréquemment des pays anglo-saxons pour ce qui est des in struments nouveaux et des méthodes nouvelles.

a method of suppression of cellular growth or enhancing immunological activity including the dministration of cpn10 antagonists or anti-cpn10 antidoby to a subject
une méthode pour inhiber la croissance cellulaire ou pour augmenter l'activité immunologique, faisant appel à l'administration au sujet d'antagonistes à la chaperonine 10 (cpn10) ou d'anticorps anti-cpn10

a method of suppression of cellular growth or enhancing immunological activity including the dministration of cpn10 antagonists or anti-cpn10 antidoby to a subject.
l'invention concerne une méthode pour inhiber la croissance cellulaire ou pour augmenter l'activité immunologique, faisant appel à l'administration au sujet d'antagonistes à la chaperonine 10 (cpn10) ou d'anticorps anti-cpn10.

a method of suppression of cellular growth or enhancing immunological activity including the dministration of cpn10 antagonists or anti-cpn10 antidoby to a subject. there is also provided antagonists to or antibody raised against cpn10 or a recombinant cpn10 which has the amino acid sequence gsagqafrkflplfdrvlversaaetvtkggimlpeksqgkvlqatveavgsgskgkggeiqpvsvkegdkvllpeyggtkvvlddkdyflfrdgdilgkyvd. there is also provided an assay for measuring anti-cpn10 antidoby in a sample including the steps of 1) reacting substantially purified cpn10 with the sample; and 2) determination of the amount of anti-cpn10 antibody in the sample by determining the binding between the antibody and cpn10.
l'invention concerne une méthode pour inhiber la croissance cellulaire ou pour augmenter l'activité immunologique, faisant appel à l'administration au sujet d'antagonistes à la chaperonine 10 (cpn10) ou d'anticorps anti-cpn10. on fournit également des antagonistes ou des anticorps contre la cpn10, ou une cpn10 de recombinaison qui a la séquence des acides aminés gsagqafrkflplfdrvlversaaetvtkggimlpeksqgkvlqatveavgsgskgkggeiqpvsvkegdkvllpeyggtkvvlddkdyflfrdgdilgkyvd. on fournit également une méthode pour doser l'anticorps anti-cpn10 dans un échantillon comprenant les étapes consistant 1) à faire réagir de la cpn10 sensiblement purifiée avec l'échantillon; et 2) à déterminer la quantité d'anticorps anti-cpn10 dans l'échantillon, en mesurant la liaison entre l'anticorps et la cpn10.