Att försöka lära sig översätta från mänskliga översättningsexempel.
Från: Maskinöversättning
Föreslå en bättre översättning
Kvalitet:
Från professionella översättare, företag, webbsidor och fritt tillgängliga översättningsdatabaser.
polypeptide conforme à la revendication 1, lequel polypeptide comporte une séquence d'acides aminés représentée par la formule suivante, à la suite de laquelle sont indiqués entre parenthèses le numéro d'identification de la séquence et les numéros des résidus correspondants : qekqnkhs (1, 427-434) anticorps qui inhibe la liaison de la protéine s à la protéine c4bp et qui réagit immunologiquement a) avec la protéine s, b) et avec un polypeptide comportant une séquence d'acides aminés représentée par la formule suivante, à la suite de laquelle sont indiqués entre parenthèses le numéro d'identification de la séquence et les numéros des résidus correspondants : sgikkiiqekqnkc (12, 1-14) mais qui ne réagit pas immunologiquement avec un polypeptide comportant une séquence d'acides aminés représentée par la formule suivante : ctckpgwqgekcefdineckdpsninggcs (1, 103-131) anticorps conforme à la revendication 5, lequel anticorps est un anticorps monoclonal.
the polypeptide of claim 1 wherein said polypeptide has an amino acid residue sequence, the seq id no and corresponding residues of which are shown in parenthesis, represented by the formula: qekqnkhs (1:427-434) an antibody that inhibits binding of protein s to c4b binding protein and that immunoreacts with: (a) protein s, and (b) a polypeptide having an amino acid residue sequence, the seq id no and corresponding residues of which are shown in parenthesis, represented by the formula: sgikkiiqekqnkc (12:1-14) but does not immunoreact with the polypeptide having an amino acid residue sequence represented by the formula: ctckpgwqgekcefdineckdpsninggcs (1:103-131). the antibody of claim 5 wherein said antibody is a monoclonal antibody.
Senast uppdaterad: 2014-12-04
Användningsfrekvens: 2
Kvalitet: