Att försöka lära sig översätta från mänskliga översättningsexempel.
Från: Maskinöversättning
Föreslå en bättre översättning
Kvalitet:
Från professionella översättare, företag, webbsidor och fritt tillgängliga översättningsdatabaser.
mélange de peptides de la revendication 18, dans lequel ledit premier peptide est constitué de iwgcsgklicttavpwnas, et ledit second peptide est constitué de averylkdqqllgxwgcsgkli.
the mixture of peptides of claim 18 wherein said first peptide consists of iwgcsgklicttavpwnas, and said second peptide consists of averylkdqqllgxwgcsgkli.
Senast uppdaterad: 2014-12-04
Användningsfrekvens: 2
Kvalitet:
peptide synthétique incluant une séquence choisie dans le groupe constitué par : csgklic, iwgcsgklicttavp, iwgcsgklicttavpwnas, averylkdqqllgiwgcsgkli, averylkddqqllgiwgcsgklicttavpwnas, lkdqqllgiwgcsgkli, llgiwgcsgklic, qqllgiwgcsgklicttavpwnas, iwgcsgklicttavpwn, csgklicttavpwnas, sgklicttavpwnas, averylkdqqllgiwgcsgklic, gcsgklicttavpwn, lkdqqllgiwgcsgk, ses fragments antigéniques et immunologiques, et ses sels pharmaceutiquement ou diagnostiquement acceptables.
a synthetic peptide including a sequence selected from the group consisting of: csgklic, iwgcsgklicttavp, iwgcsgklicttavpwnas, averylkdqqllgiwgcsgkli, averylkdqqllgiwgcsgklicttavpwnas, lkdqqllgiwgcsgkli, llgiwgcsgklic, qqllgiwgcsgklicttavpwnas, iwgcsgklicttavpwn, csgklicttavpwnas, sgklicttavpwnas, averylkdqqllgiwgcsgklic, gcsgklicttavpwn, lkdqqllgiwgcsgk, the antigenic and immunologic fragments thereof, and pharmaceutically or diagnostically acceptable salts thereof.
Senast uppdaterad: 2014-12-04
Användningsfrekvens: 2
Kvalitet: