Results for nlmkqgasgikeiiq translation from French to English

polypeptide de la revendication 3 où ledit polypeptide a une séquence de résidus d'acides aminés, dont seq id no et les résidus correspondants sont montrés entre parenthèses, représentée par une formule sélectionnée dans le groupe consistant en: sgikeiiqekqnkhc, (1:420-434) sgikeiiqekqnkhs, (2:1-15) sgvkeiiqekqnkhs, (3:1-15) keiiqekqnkhs, et (2:4-15) cirswnlmkqgasikeiiqekqnkhc (11:1-26) polypeptide de la revendication 1 où ledit polypeptide a une séquence de résidus d'acides aminés, dont seq id no et les résidus correspondants sont montrés entre parenthèses, représentée par une formule sélectionnée dans le groupe consistant en sgikeiiqkkqnkc, (13:1-14) gasgikeiiqekqnk, (1:418-432) gikeiiq (1:421-427) gasgikeiiqekqnk, et (1:418-432) nlmkqgasgikeiiq anticorps qui inhibe la liaison de la protéine s à la protéine liant c4b et qui immunoréagit avec: (a) la protéine s, et (b) un polypeptide ayant une séquence de résidus d'acides aminés, dont seq id no et les résidus correspondants sont montrés entre parenthèse, représentée par une formule sélectionnée dans le groupe consistant en: sgikeiiqekqnkhc, (1:420-434) gasgikeiiqekqnk, (1:418-432) nmlkqgasgikeiiq, (1:413-427) cirswnlmkqgasikeiiqekqnkhc, et (11:1-26) sgikeiiqkkqnkc (13:1-14) mais n'immunoréagit pas avec le polypeptide ayant une séquence de résidus d'acides aminés représentée par la formule: ctckpgwqgekcefdineckdpsninggcs (1:103-131).
the polypeptide of claim 3 wherein said polypeptide has an amino acid residue sequence, the seq id no and corresponding residues of which are shown in parenthesis, represented by a formula selected from the group consisting of: sgikeiiqekqnkhc, (1:420-434) sgikeiiqekqnkhs, (2:1-15) sgvkeiiqekqnkhs, (3:1-15) keiiqekqnkhs, and (2:4-15) cirswnlmkqgasikeiiqekqnkhc (11:1-26). the polypeptide of claim 1 wherein said polypeptide has an amino acid residue sequence, the seq id no and corresponding residues of which are shown in parenthesis, represented by a formula selected from the group consisting of sgikeiiqkkqnkc, (13:1-14) gasgikeiiqekqnk, (1:418-432) gikeiiq (1:421-427) gasgikeiiqekqnk, and (1:418-432) nlmkqgasgikeiiq (1:413-427). an antibody that inhibits binding of protein s to c4b binding protein and that immunoreacts with: (a) protein s, and (b) a polypeptide having an amino acid residue sequence, the seq id no and corresponding residues of which are shown in parenthesis, represented by a formula selected from the group consisting of: sgikeiiqekqnkhc, (1:420-434) gasgikeiiqekqnk, (1:418-432) nlmkqgasgikeiiq, (1:413-427) cirswnlmkqgasikeiiqekqnkhc, and (11:1-26) sgikeiiqkkqnkc (13:1-14) but does not immunoreact with the polypeptide having an amino acid residue sequence represented by the formula: ctckpgwqgekcefdineckdpsninggcs (1:103-131).